SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018079 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018079
Domain Number 1 Region: 30-522
Classification Level Classification E-value
Superfamily Sema domain 3.27e-176
Family Sema domain 0.0000000000577
Further Details:      
 
Domain Number 2 Region: 518-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000227
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 591-672
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000605
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018079   Gene: ENSNLEG00000014841   Transcript: ENSNLET00000018976
Sequence length 775
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:14364922:14640598:-1 gene:ENSNLEG00000014841 transcript:ENSNLET00000018976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAGHIITLLLWGYLLELWTGGHTADTTHPRLRLSHKELLNLNRTSIFQSPFGFLDLRT
MLLDEYQERLFVGGRDLVYSLSLERISDGYKEIHWPSTALKMEECIMKGKDAGECANYVR
VLHHYNRTHLLTCGTGAFDPVCAFIRVGYHLEDPLFHLESPRSERGRGRCPFDPSSSFIS
TLIGSELFAGLYSDYWSRDAAIFRSMGRLAHIRTEHDDERLLKEPKFVASYMIPDNEDRD
DNKVYFFFTEKALEAENNAHAIYTRVGRLCGNDVGGQRILVNKWSTFLKARLICSVPGMN
GIDTYFDELEDVFLLPTRDHKNPVIFGLFNTTSNIFRGHAICVYHMSSIRAAFNGPYAHK
EGPEYHWSVYEGKVPYPRPGSCASKVNGGRYGTTKDYPDEAIRFARSHPLMYQAIKPAHK
KPILVKTDGKYNLKQIAVDRVEAEDGQYDVLFIGTDNGIVLKVITIYNQEMESMEEVILE
ELQIFKDPVPIISMEISSKRQQLYIGSASAVAQVRFHHCDMYGSACADCCLARDPYCAWD
GISCSRYYPTGTHAKRRFRRQDVRHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLL
ECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVKMDLGLLFLRLRKSDAGTYFCQTVEHS
FVHTVRKITLEVVEEEKVEDMFNKDDEEDRHHRMPCPAQSSISQGAKPWYKEFLQLIGYS
NFQRVEEYCEKVWCTDRKRKKLKMSPSKWKYANPQEKKLRSKPEHYRLPRHTLDS
Download sequence
Identical sequences A0A2I3G8K3
ENSNLEP00000018079 ENSNLEP00000018079 XP_003252337.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]