SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018098 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018098
Domain Number 1 Region: 28-520
Classification Level Classification E-value
Superfamily Sema domain 2.22e-193
Family Sema domain 0.00000000000000428
Further Details:      
 
Domain Number 2 Region: 516-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000732
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 585-667
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000181
Family V set domains (antibody variable domain-like) 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018098   Gene: ENSNLEG00000014865   Transcript: ENSNLET00000018996
Sequence length 771
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:14982751:15211511:-1 gene:ENSNLEG00000014865 transcript:ENSNLET00000018996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLTRIVCLFWGVLLTARANYQNGKNNVPRLKLSYKEMLESNNVITFNGLANSSSYHTF
LLDEERSRLYVGAKDHIFSFNLVNIKDFQKIVWPVSYTRRDECKWAGKDILKECANFIKV
LKAYNQTHLYACGTGAFHPICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASL
LIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISESDNPED
DKVYFFFRENAIDGEHSGKATHARIGQICKNDFGGHRSLVNKWTTFLKARLICSVPGPNG
IDTHFDELQDVFLMNFKDPKNPIVYGVFTTSSNIFKGSAVCMYSMSDVRRVFLGPYAHRD
GPNYQWVPYQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVITFARSHPAMYNPVFPMNNRP
IVIKTDVNYQFTQIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSIPKETWHDLEEVLLEEM
TVFREPTAISAMELSTKQQQLYIGSTAGVAQLPLHRCDIYGKACAECCLARDPYCAWDGS
ACSRYFPTAKRRTRRQDIRNGDPLTHCSDLHHDNHHGHSPEERIIYGVENSSTFLECSPK
SQRALVYWQFQRRNEERKEEIRVDDHIIRTDQGLLLRSLQQKDSGNYLCHAVEHGFIQTL
LKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDE
FCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRSV
Download sequence
Identical sequences G1RXX1
ENSNLEP00000018098 XP_003252360.1.23891 ENSNLEP00000018098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]