SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018105 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018105
Domain Number 1 Region: 610-802
Classification Level Classification E-value
Superfamily Fibronectin type III 3.75e-38
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 2 Region: 378-479
Classification Level Classification E-value
Superfamily Fibronectin type III 8.25e-25
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 3 Region: 509-611
Classification Level Classification E-value
Superfamily Fibronectin type III 6.92e-22
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 4 Region: 151-246
Classification Level Classification E-value
Superfamily Immunoglobulin 3.33e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 278-373
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000735
Family I set domains 0.017
Further Details:      
 
Domain Number 6 Region: 867-910
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000569
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 7 Region: 934-993
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000151
Family V set domains (antibody variable domain-like) 0.087
Further Details:      
 
Domain Number 8 Region: 1127-1212
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000177
Family I set domains 0.037
Further Details:      
 
Domain Number 9 Region: 1244-1307
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00001
Family V set domains (antibody variable domain-like) 0.046
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018105
Domain Number - Region: 1026-1103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00333
Family I set domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018105   Gene: ENSNLEG00000014874   Transcript: ENSNLET00000019003
Sequence length 1453
Comment pep:known_by_projection supercontig:Nleu1.0:GL397337.1:1717461:1813039:1 gene:ENSNLEG00000014874 transcript:ENSNLET00000019003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVAVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRSAAQVPASSTVSSGRKHPRAGVQ
TSGGTICRVCAKRVSTQEEEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQ
ARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFAVQGFP
TPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDSATYSAVATNAHGQVSTN
AAVVVRRFRGDEEPFRSVGLPIGLPLSSVIPYTHFDVQFLEKFGVTFRREGETVTLKCTM
LVTPDLKRVQPRAEWYRDDVLLKESKWTKMFFGEGQASLSFSHLNKDDEGLYTLRIVSRG
GVSDHSAFLFVRDADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDR
CEVGTNNWVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPL
DLRRLQAVHLEGEKEIVIYQDDLEGDAQVPGPPTNVHASEISRNYVVLSWEPPTPRGKDP
LMYFIEKSLVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITS
PIQAQDVTVVPSAPGRVLASRNTKTSVVVQWDRPKHEEDLLGYYVDCCVAGTNVWEPCNH
KPIGYNRFVVHGLTTGEQYIFRVKAVNAVGMSENSQESDIIKVQAALTVPSHPYGITLLN
CDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSTPTILTVDGLTEGSLY
EFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGDSWDHRFMSPCPANIFSLFSQPLHHMS
SELPWVFVEAAAISLINFILPPHIWCVLCCFKVSNLQQGKTYVFRVRAVNANGVGKPSDT
SEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEIADDERFKIETV
GDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSE
LAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFS
IENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVT
EECEVRLVCKVANTKKETAFKWLKDDVLYETKTLPDLERGICELLIPKLSKKDHGEYKAT
LKDDRGQDVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTEEMK
VNWCHKDAKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQ
AFDEAFAEQQLKAAAFAEKNRGRLIGGLPDVVTIMEGKVRNLNLAGAGVGNPVRGFCVSL
SLQGTQSPPDFPAPPRQLGITPVFSKEGITSNVVEFIDVTVSVYKHGEKIPDMAPPQQAK
PKLIPASASAPGQ
Download sequence
Identical sequences ENSNLEP00000018105 ENSNLEP00000018105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]