SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018107 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018107
Domain Number 1 Region: 41-537
Classification Level Classification E-value
Superfamily Sema domain 2.35e-184
Family Sema domain 0.0000000000153
Further Details:      
 
Domain Number 2 Region: 533-585
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 601-683
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000511
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018107   Gene: ENSNLEG00000014879   Transcript: ENSNLET00000019005
Sequence length 777
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:16043008:16168709:-1 gene:ENSNLEG00000014879 transcript:ENSNLET00000019005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNANKDERLKARSQDFHLFPALMMLSMTMLFLPVTGTSKQNIPRLKLTYKDLLLSNSCIP
FLGSSEGLDFQTLLLDEERGRLLLGAKDHIFLLSLVDLNKNFKKIYWPAAKERVELCKLA
GKDANTECANFIRVLQPYNKTHIYVCGTGAFHPICGYIDLGVYKEDIIFKLDTHNLESGR
LKCPFDPQQPFASVMTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNG
AKFIGTFSIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVGGQRSLINKW
TTFLKARLICSIPGNDGADTYFDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVY
SMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISF
IKRHSVMYKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQYDVMFLGTDIGTVLKVV
SISKEKWNMEEVVLEELQIFKHSSIILNMELSLKQQQLYIGSQDGLVQLSLHRCDTYGKA
CADCCLARDPYCAWDGNACSRYAPTSKRRARRQDVKYGDPITQCWDIKDSISHETADEKV
IFGIEFNSTFLECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
GMYYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGQVKDLLAESRLRYKDYIQIL
SSPNFSLDQYCEQMWHREKRRQRNKGGPKWKHMQEMKKKRNRRHHRDLDEFPRAVAT
Download sequence
Identical sequences G1RXY0
ENSNLEP00000018107 XP_003252365.1.23891 ENSNLEP00000018107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]