SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018111 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018111
Domain Number 1 Region: 143-261
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-27
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number 2 Region: 30-65,98-168
Classification Level Classification E-value
Superfamily Fibronectin type III 7.95e-26
Family Fibronectin type III 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018111
Domain Number - Region: 44-99
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0457
Family Fibronectin type III 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018111   Gene: ENSNLEG00000014887   Transcript: ENSNLET00000019009
Sequence length 263
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:28952045:28982014:-1 gene:ENSNLEG00000014887 transcript:ENSNLET00000019009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPKHCFLGFLISVFLTGVAGTQPAHESLKPQRVQFQSRNFHNILQWKPGRALTGNSSVY
FVQYKIMFSCSKKSSHQKPSGCWQHTSCNFPGCRTWAKYGQRQWKNKEDCWGTQELFCDL
TSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHA
PNLPYRYQKEKNISIEDYYELVYRVFIINNSLEKEQKVYEGVHRMVEIEALIPHSSYCVV
AEIYQPMLDRRSQRSEERCVEIP
Download sequence
Identical sequences A0A2I3HJU6
ENSNLEP00000018111 ENSNLEP00000018111 XP_003255823.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]