SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018119 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018119
Domain Number 1 Region: 479-594
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-33
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1523-1643
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-32
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 3 Region: 316-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 4 Region: 1179-1285
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-32
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 5 Region: 1696-1816
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-31
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 6 Region: 998-1119
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-30
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 7 Region: 1867-1986
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-29
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 8 Region: 139-249
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 9 Region: 2054-2157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-28
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 838-940
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 11 Region: 658-767
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1346-1461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-22
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 
Domain Number 13 Region: 2407-2475
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.04e-19
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 14 Region: 2763-2834
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-19
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 15 Region: 2464-2533
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.8e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 2647-2715
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-17
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 17 Region: 2522-2595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.39e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 18 Region: 2823-2892
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.17e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 2704-2774
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.12e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 20 Region: 2943-3011
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000229
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 21 Region: 1118-1182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000243
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 2221-2288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 23 Region: 2881-2938
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000556
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 24 Region: 425-493
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 25 Region: 943-1013
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000278
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 26 Region: 255-316
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 27 Region: 2348-2411
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000334
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 28 Region: 2579-2641
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 29 Region: 1292-1356
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000584
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 30 Region: 2159-2232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000648
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 31 Region: 75-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 32 Region: 1814-1883
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 33 Region: 600-660
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000175
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 34 Region: 1468-1531
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000189
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 35 Region: 1642-1706
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000162
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 36 Region: 1985-2049
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000391
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 37 Region: 773-833
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000542
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 38 Region: 3002-3059
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000625
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 39 Region: 2303-2359
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000431
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 40 Region: 2-38
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000445
Family Spermadhesin, CUB domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018119   Gene: ENSNLEG00000014886   Transcript: ENSNLET00000019018
Sequence length 3292
Comment pep:known_by_projection supercontig:Nleu1.0:GL397337.1:2603649:3458784:-1 gene:ENSNLEG00000014886 transcript:ENSNLET00000019018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSHK
NSVLSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQRV
TETLAAWSDHRPICRARTCGSNLRGPSGVITSPNYPVQYEDNAHCVWVITTSDPDKVIKL
AFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIGS
PGFKAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQ
WSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVE
PQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTF
GQNECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVP
RCEAPCGGHLTASSGVILPPGWPGYYKDSLNCEWIIEAKPGHSIKITFDRFQTEVNYDTL
EVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDS
CLDPGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGG
YIQGKTGTVLSPGFPDFYPNSLNCTWTIEVSHGKGVQMIFHTFHLESSHDYLLITEDGSF
SEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPA
FSRRIGFQFGVGDSLTFSCFPGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNE
GTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRARSFQLFEGDTLKVYDGKDSSSRPLGT
FTKNELLGLILNSTSNHLWLEFNTNGSDTNQGFQLTYTSFELVKCEDPGIPNYGYRIRDE
GHFTDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILSP
GYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTETAHDILKVWDGPVGSNILLKEWSGSA
LPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGDT
VTFQCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYP
PGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNSPLIGSYQGSQAPERVES
SGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTVTYQCDS
GYKIVDPSSITCVIGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGEVCI
YYITVPKEFVVFGQFAYFQTALNDLAELFDGTHAQARLLSSLSGSHSGETLPLATSNQIL
LRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYL
LQGSTALHCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKI
IVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTAPRLGSFSGTTVPALLNSTSNQLYLHF
QSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRSH
ISCMPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYGA
HIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSGTDLPAALLSTTHETLIHFYSDHSQNR
QGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSISFECYPGYILIGHPVLTCQHGIN
RNWNYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLLQ
TEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAYSSSNQVLLKFHSDFSNGGFFVLNFHA
FQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDTLTCKLSSQLQFEGSL
PTCEAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQF
DALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSNQLYLRWSADHATSKKGFKIRYAAPYC
SLTHTLKNGGILNRTAGAVGSKVHYFCKPGYRMIGHSNATCRRNPLGMYQWDSLMPVCQA
VSCGIPEAPGNGSFTGNEFTLDSKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPTC
KPVPCPSIEAQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYYLEGRRLVQCQANGTWNIGD
ERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGTE
TRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTPV
CVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSGAQCRSNGQWSSPLPTCR
VVNCSDPGFVENAIRQGQQNFPESFEYGMSVLYHCKKGFYLLGSSVLTCMANGLWDRSLP
KCLAISCGHPGVPANAVLTGELFTYGAIVRYSCRGSQTLVGNDTRVCQGDSHWSGALPHC
TGNNPGFCGDPGTPAHGSRLGDEFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQPV
CEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDC
TIISCGDPGTLANGIQFGNDFTFNKTVSYQCNPGYLMEPVTSATIRCTKDGTWNQSKPVC
KAVLCPQPPPVPNGTVEGTDFRWGSSISYSCVDGYQLSHSAILSCEGRGVWKGEIPQCLP
VFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRICQADGMWSGMQPTCVDPA
HNNCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGTQTACIP
HACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMRWTGKSPVCKS
KGVREVNETVTKTPVPSDVFFVNSVWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSEA
SPVELKLTGVYKKEEAHLLLKSFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQG
DIHGKDFGKFKLERQDPLNPDQDSSNHYHGTSSGSVAAAILVPFFALILSGFAFYLYKHR
TRPKVQYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences ENSNLEP00000018119 ENSNLEP00000018119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]