SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018144 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018144
Domain Number 1 Region: 669-876
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000000000693
Family Mannose 6-phosphate receptor domain 0.0063
Further Details:      
 
Domain Number 2 Region: 600-675
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000126
Family Growth factor receptor domain 0.0056
Further Details:      
 
Domain Number 3 Region: 285-431
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000314
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018144   Gene: ENSNLEG00000014894   Transcript: ENSNLET00000019045
Sequence length 1029
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:17822246:18003778:-1 gene:ENSNLEG00000014894 transcript:ENSNLET00000019045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFRARGPVRGRGRGRPAEAPRRGRSPPWSPAWICCWALAGCQAAWAGDLPSTSSHPLPP
CQEKDYHFEYTECDSSGSRWRVAIPNSAVDCSGLPDPVRGKECTFSCASGEYLEMKNQVC
SKCGEGTYSLGSGIKFDEWDELPAGFSNIATFMDTVVGPSDSRPDGCNNSSWIPRGNYIE
SNRDDCTVSLIYAVHLKKSGYVFFEYQYVDNNIFFEFFIQNDQCQEMDTTTDKWVKLTDN
GEWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNITIEGVAYTSECFPCKPGTFSN
KPGSFNCQVCPRNTYSEKGAKECIRCKDDSQFSEEGSSECTERPPCTTKDYFQIHTPCDE
EGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTFSD
GTKECRPCPAGTEPALGFEYKWWNVLPGNMKTSCFNVGNSKCDGMNGWEVAGDHIQSGAG
GSDNDYLILNLHIPGFKPPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRKSTNV
VESWGGTKEKQAYTHIIFKNATFTFTWAFQRTNQGQDNRRFINDMVKIYSITATNAVDGV
ASSCRACALGSEQSGSSCVPCPPGHYIEKETNQCKECPPDTYLSIHQVYGKEACIPCGPG
SKNNQDHSVCYSDCFFYHEKENQSLHYDFSNLSSMGSLMNGPSFTSKGTKYFHFFNISLC
GHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSII
LADTFLGVTVETTLQNINIKEDMFPVPASQIPDVHFFYKSSTATTSCINGRSTAVKMRCN
PTKSGAGVISVPSKCPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACKRGFQETLYV
WNEPKWCIKGISLPEKKLATCETVDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLEYKY
SKLVMTTNSKECELPAADSCAIMEGEDNEEEVVYSNKQSLLGKLKSLATKEKEDHFESVQ
LKTSRSPNI
Download sequence
Identical sequences G1RY17
ENSNLEP00000018143 ENSNLEP00000018144 XP_012365685.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]