SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018145 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018145
Domain Number 1 Region: 143-251
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-25
Family Cadherin 0.00024
Further Details:      
 
Domain Number 2 Region: 252-367
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 371-457
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-19
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 64-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000014
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 511-615
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000007
Family Cadherin 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018145   Gene: ENSNLEG00000014900   Transcript: ENSNLET00000019046
Sequence length 819
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:2226142:2236440:-1 gene:ENSNLEG00000014900 transcript:ENSNLET00000019046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLVRLLLAWLGGWGCMGRLAAPARAWAGSRGHPGPALLRTRRSWVWNQFFVIEEYAGP
EPVLIGKLHSDVDRGEGRTKYLLTGEGAGTVFVIDEATGNIHVTKSLDREEKAQYVLLAQ
AVDRASNRPLEPPSEFIIKVQDINDNPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDP
SYGNSAKLVYTVLDGLPFFSVDPQTGVVRTAIPNMDRETQEEFLVVIQAKDMGGHMGGLS
GSTTVTVTLSDVNDNPPKFPQSLYQFSVVETAGPGTLVGRLRAQDPDLGDNALMAYSILD
GEGSEAFSISTDPQGRDGLLTVRKPLDFESRRSYSFRVEATNTLIDPAYLRRGPFKDVAS
VRVAVQDAPEPPAFTQAAYHLTVPENKAPGTLVGQISAADLDSPASPIRYSILPHSDPER
CFSIQPEAGTIHTAAPLDREARVWHNLTVLATELGWSWGPERGWVPPLIAKWSAPAAPPQ
RSPVGSPVGIPQDSSAQASRVQVAIQTLDENDNAPQLAEPYDTFVCDSAAPGQLIQVIRA
LDRDEVGNSSHVSFQGPLGPDANFTVRDNRDGSASLLLPSRPAPPRHAPYLVPIELWDWG
QPALSSTATVTVSVCRCQPDGSVASCWPEAHLSAAGLSTGALLAIITCVGALLALVVLFV
ALRRQKQEALMVLEEEDVRENIITYDDEGGGEEDTEAFDITALQNPDGAAPPAPGPPARR
DVLPRARVSRQPRPPGPADVAQLLALRLREADEDPSVPPYDSVQVYGYEGRGSSCGSLSS
LGSGSEAGGAPGPAEPLDDWGPLFRTLAELYGAKEPPAP
Download sequence
Identical sequences G1RY18
XP_003260679.1.23891 ENSNLEP00000018145 ENSNLEP00000018145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]