SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018201 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018201
Domain Number 1 Region: 35-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000808
Family I set domains 0.052
Further Details:      
 
Domain Number 2 Region: 138-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000305
Family C1 set domains (antibody constant domain-like) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018201   Gene: ENSNLEG00000014968   Transcript: ENSNLET00000019106
Sequence length 343
Comment pep:known_by_projection supercontig:Nleu1.0:GL397288.1:6656417:6687460:-1 gene:ENSNLEG00000014968 transcript:ENSNLET00000019106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSHLNRLLFWSIFSSVTCRKAVLDCEAMKTNEFPSPCLDSKTNVVMKGQNVSMFCSHKN
KSLQITYSLFRHKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFT
IVDPVTAPVLNIMVMQIETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAE
FNLTKKNPGEEEEYRCEAKNRLPNYATYSQPVTMPSTGGDSCPFCLKLLLPGLLLLLVVI
ILILAFWVLPKYKARKAMRNNVPRDCGGPAVEVGIYANILEKQAKEESVPEVGSRPCVST
AQDEAEHSQELQYATPVFQEVAPREQEACDSYKSGYVYSELNF
Download sequence
Identical sequences G1RY74
ENSNLEP00000018201 XP_003262679.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]