SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018230 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000018230
Domain Number - Region: 2-45
Classification Level Classification E-value
Superfamily RING/U-box 0.000145
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018230   Gene: ENSNLEG00000014991   Transcript: ENSNLET00000019138
Sequence length 300
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:2398815:2432326:1 gene:ENSNLEG00000014991 transcript:ENSNLET00000019138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWFHCNQCFRKDGAHFFVTSCGHIFCKKCVTLEKCAVCGTACKHLALSDNLKPQEKMFF
KSPVETALQYFSHISQVWNFQKKQTDLLIAFYKHRITKLETAMQEAQQALVSQDKELSVL
RKENGELKKFLAILKESPSRYQGSRSNTPRPVGITSPSQSVTPRPSFQHSSQVVSRSSSA
ESIPYREAGFGSLGQGGRGLQGRRTPRDSYNETPSPASTHSLSYRPSSASSGQGIFSFRP
SPNGHSGHTRVLTPNNFAQRESRTTLESLPSFQLPVLQTLYQQQRQMGLPSGREAWTTSR
Download sequence
Identical sequences G1RYA3
XP_003260992.2.23891 ENSNLEP00000018230 ENSNLEP00000018230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]