SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018255 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018255
Domain Number 1 Region: 52-169
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-32
Family C-type lectin domain 0.00000509
Further Details:      
 
Domain Number 2 Region: 265-331
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 210-275
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000528
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 170-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family EGF-type module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018255   Gene: ENSNLEG00000015016   Transcript: ENSNLET00000019163
Sequence length 385
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:20017558:20042265:-1 gene:ENSNLEG00000015016 transcript:ENSNLET00000019163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCRRTREGPSKVMIFPWKCQSTQGDLWNIFKLWGWTMLCCDILAHHGTDCWTYHYSEKP
MNWQRARRFCRENYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSL
TEEAENWGDGEPNNKKNKEDCVEIYIKRKKDAGKWNDDACHKLKAALCYTASCQPWSCSG
HGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMACTHPLGNFSFSSQCAFKC
SEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTF
ICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSG
LAFIIWLARRLKKGKKSKKSMDDPY
Download sequence
Identical sequences A0A2I3H1K0
ENSNLEP00000018255 ENSNLEP00000018255 XP_003258894.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]