SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018277 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018277
Domain Number 1 Region: 500-592
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000641
Family I set domains 0.027
Further Details:      
 
Domain Number 2 Region: 40-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000257
Family I set domains 0.053
Further Details:      
 
Domain Number 3 Region: 408-496
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000013
Family I set domains 0.035
Further Details:      
 
Domain Number 4 Region: 335-405
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000251
Family V set domains (antibody variable domain-like) 0.071
Further Details:      
 
Domain Number 5 Region: 234-325
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000517
Family I set domains 0.043
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018277
Domain Number - Region: 148-209
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0514
Family C2 set domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018277   Gene: ENSNLEG00000014972   Transcript: ENSNLET00000019186
Sequence length 737
Comment pep:known_by_projection supercontig:Nleu1.0:GL397288.1:6751805:6817610:1 gene:ENSNLEG00000014972 transcript:ENSNLET00000019186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD
VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT
SEYQLLVEGVPSPRVTLDKKEAIQGGVVRVNCSVPEEKAPIHFTIEKLELNKKTAKQKRE
KTSRDQNFVMLEFTVEEQDHVLSFRCQARIVSGIHVQTSESTKSELVTVTESFSTPKFHI
SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHRRHGNEAVYSVTAMVEHNG
NYTCKVESSRISKVSSIVVNITELFSKPELETSFTRLDQGERLNLSCSIPGAPPANFTIQ
KEDTIVSQTQDFTKIASKWDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE
VIKGQTIEVSCQSISGTSPISYRLLKTSKVLESSTKNSSDPAVFKDNPTEDVEYQCVADN
CHSHAEILSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK
EGKPFYQMTSNATQAFWTKPKASKEQEGEYYCIAFNRANHASSVPRSKILTVRVVLAPWK
KGLIAVVVIGVIIALLIIGAKCYFLRKAKGEHIFQMREPAVPLLNSNNEKMSDPSMEANS
HYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVP
DAVESRYSRTEGSLDGT
Download sequence
Identical sequences ENSNLEP00000018277 ENSNLEP00000018277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]