SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018307 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018307
Domain Number 1 Region: 39-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-31
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 152-343
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000026
Family Pentraxin (pentaxin) 0.0051
Further Details:      
 
Domain Number 3 Region: 857-1137
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000915
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018307   Gene: ENSNLEG00000015064   Transcript: ENSNLET00000019218
Sequence length 1247
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:34105790:34242191:1 gene:ENSNLEG00000015064 transcript:ENSNLET00000019218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRSDRMWSCHWKWKPSPLLFLFALYIICIPHSVWGCANCRVVLSNPSGTFASPCYPNDY
PNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFN
SSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSVSIPELS
AFTLCFEATKVGHEDNDWTAFSYSNASFTQLLSFGKAKNGYFLSISDSKCLLNNALPVKE
KEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSSQNEIV
SLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAEGNLSCGSYLI
PLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQNI
LRHPEVKVQTKVAEWLNSTFQNWNYTVYVVNISFHLSAGEDKIKVKRSIENEPRLVLWAL
LVYNATNNTNLEGKIXXXXXXXXXXXXVNISHAGSYVHVGHCLAVEEPKGYYWPSIQPSE
YVLPCPDKPGFSASRICSYNATNPLVTYWGPVDISNCSKEANEVANQILNLTADGQNLTS
ANITNIVEQVKRIVNKEENIDITLGSTLMNIFSNILSSSDSDLLESSSEALKTIDELAFK
IDLNSTSHVNIATRNLALGVSSLLPGTNGISNFSIGLPSNNESYFQMDFESGQVDPLASV
ILPPNLLENLSQEDSVLVRRAQFTFFNKTGLFQDVGPQRKTLVSYVMACSIGNITIQNLK
DPVQIKIKHTRTQEVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASETICLCNHFTHF
GVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKLRRDYPSKILMN
LSTALLFLNLLFLLDGWITSFNVDGFCIAVAVLLHFFLLATFTWMGLEAIHMYIALVKVF
NTYIRRYILKFCIIGWGLPALVVSIVLASRNKNEVYGKESYGKEKGDEFCWIQDPVIFYV
TCAGYFGVMFFLNIAMFIVVMVQICGRNGKRSNRTLREEVLRNLRSVVSLTFLLGMTWGF
AFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKENVQKQWRRHLCCGRFRLADNSDWS
KTATNIIKKSSDNLGKSLSSSSIGSSSTYLTSKSKSSSTTYFKRNSHTDNASMDKSLSKL
AHADGDQTSIIPVHQVIDKVKGYCNAHSDNFYKNIIMSDTFSHSTKF
Download sequence
Identical sequences ENSNLEP00000018307 ENSNLEP00000018307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]