SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Nomascus leucogenys 76_1.0 > ENSNLEP00000018344

Domain assignment for ENSNLEP00000018344 from Nomascus leucogenys 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSNLEP00000018344
Domain Number 1	Region: 25-110
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	1.69e-29
Family	I set domains	0.0000106
Further Details:

Domain Number 2	Region: 108-204
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	3.25e-19
Family	C2 set domains	0.000007
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSNLEP00000018344 Gene: ENSNLEG00000015088 Transcript: ENSNLET00000019255
Sequence length	275
Comment	pep:known_by_projection supercontig:Nleu1.0:GL397288.1:7117903:7136145:1 gene:ENSNLEG00000015088 transcript:ENSNLET00000019255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSSFGYRTLTVALFALICCPGSDEKVFEVHVRPKKLVVEPEGSLEVNCSTTCNQPEVGGL ETSLDKRLLEEQPQWKHYLVSNISHDTVLQCHFTCSGKQESMSSNISVYQPPRQVLLTLQ PTWVAVGKSFTIECRVPTVKPLDSLTLFLFRGNETLHSQTFGKAAPALQEATATFSSTAH REDGHHNFSCLAVLDLMSHGGNIFCKHSAPKMLEIYEPVSDSQMVIIVTVVSVLLFLFVT SVLLCFIFSQHWRQQRTGTYGVRAAWRRLPQAFRP
Download sequence
Identical sequences	G1RYL7 ENSNLEP00000018344 XP_003262689.1.23891 XP_003262690.1.23891 XP_004091546.1.23891 XP_004091547.1.23891 ENSNLEP00000018344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]