SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018381 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018381
Domain Number 1 Region: 48-143
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000217
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018381   Gene: ENSNLEG00000015121   Transcript: ENSNLET00000019294
Sequence length 230
Comment pep:known_by_projection supercontig:Nleu1.0:GL397288.1:7205268:7209401:1 gene:ENSNLEG00000015121 transcript:ENSNLET00000019294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLALSPVPGHWMVALLLLLSAAEPVPAPGSEHLYPNPKGSACSRIWQTPRFIARKRGF
TVKMHCYVNGASDNVTWLWKRETDEEPRQLKLEPGHMQKTHNKSVTTLTIQGIRFEDNGI
YFCQQECNNTSEVYLGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFL
LLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Download sequence
Identical sequences XP_003262692.1.23891 ENSNLEP00000018381 ENSNLEP00000018381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]