SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018388 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018388
Domain Number 1 Region: 197-236
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000707
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018388   Gene: ENSNLEG00000015139   Transcript: ENSNLET00000019301
Sequence length 241
Comment pep:known_by_projection supercontig:Nleu1.0:GL397330.1:10237587:10330796:1 gene:ENSNLEG00000015139 transcript:ENSNLET00000019301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPS
ASGGATAASAAPAAPRSRSLGGAVGSVASGTRAAQSSFSIPNSSSGPYGSQDSVHSSPED
GGGGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKVPSDEMDLHLVMCLT
KPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHPS
D
Download sequence
Identical sequences ENSNLEP00000018388 ENSNLEP00000018388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]