SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018395 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018395
Domain Number 1 Region: 1-228
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.81e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0052
Further Details:      
 
Domain Number 2 Region: 312-491
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000105
Family FAD/NAD-linked reductases, N-terminal and central domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018395   Gene: ENSNLEG00000015146   Transcript: ENSNLET00000019309
Sequence length 539
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:21435441:21505931:1 gene:ENSNLEG00000015146 transcript:ENSNLET00000019309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFS
NSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTLVSSRKKCPSFL
VMGQWVVVTEKDGKQESTIFDAVMICSGHHVYSNLPTDSFPGLDQFRGNYFHSWDYKNPE
AFKGKRVLVIGLGNSGSDIAVELSRLATQVIVSTRSGSWVMSRVWDDGYPSDMIYVTRFA
SFLQNVLPSFVSDWLYVQKMNTWLKHENYGLMPLNGSLRKEPVFNDELPSRILCGTLSIK
PSVKEFTETSAVFEDGTVFEAIDSVIFATGYDYSYPFLDETIMKSRNNEVTLFKGIFPPL
MEKPTLAVIGLVQSLGAAIPTANLQARWAAKVFANSCTLPTTNEMTDDIDEKMGKKLKCV
FSSFFRFGQSQTLQTDYITYMDELGSFIGAKPNITWLFLTDPRLALEVYFGPCSPHQFRL
MGPGKWDGARNAILTQWNRTVKPTRTRVVSEAQRPHPFYNLLKMLSFPLLLLAVTLPFY
Download sequence
Identical sequences ENSNLEP00000018395 ENSNLEP00000018395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]