SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018403 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018403
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.004
Further Details:      
 
Domain Number 2 Region: 312-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000492
Family FAD/NAD-linked reductases, N-terminal and central domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018403   Gene: ENSNLEG00000015146   Transcript: ENSNLET00000019317
Sequence length 532
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:21435441:21461832:1 gene:ENSNLEG00000015146 transcript:ENSNLET00000019317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFS
NSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKRPDFA
TTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPG
VFNGKRVLVVGLGNSGCDIATELSHTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFG
TFLRNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPACILCGIVSVK
PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFFDDSIIKSRNNEIILFKGVFPPL
LEKSTIAVIGFVQSLGAAIPTADLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAVEVYFGPCSPYQFRLVGPGKWP
GARNAILTQWDRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILFIAVFLVLT
Download sequence
Identical sequences G1RYS6
XP_003258913.1.23891 XP_003258914.1.23891 ENSNLEP00000018403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]