SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018408 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018408
Domain Number 1 Region: 3-241
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.27e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0025
Further Details:      
 
Domain Number 2 Region: 312-485
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000138
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018408   Gene: ENSNLEG00000015155   Transcript: ENSNLET00000019322
Sequence length 535
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:21538398:21573502:1 gene:ENSNLEG00000015155 transcript:ENSNLET00000019322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGVWRFKENVEDGRASIYQSVVT
NTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFRIFVKKFDLLKYIQFQTTVLSVRKCPDFS
SSSQWKVVTQSNGKEQSAVFDAVMVCSGHHILPHIPLKSFPGIEKFKGQYFHSRQYKHPD
GFEGKRILVIGMGNSGSDIAVELSKNAAQVFISTRHGTWVMSRISEDGYPWDSVFHTRFR
SMLRNVLPRTAVKWMIEQQMNRWFNHENYGLEPQNKYIMKEPVLNDDVPSRLLCGAITVK
STVKELTETSAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMVSLYKYIFPAH
LEKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLPSKRTMMMDIIKRNEKRIDLF
GESQSQTLQINYVDYLDELALEIGAKPEFCSLLFKDPKLAVRLYFGPCNSYQYRLVGPGQ
WEGARSAIFTQKQRILKPLKTRALKDSSNFSVSFLLKILGLLAVVVAFFCQLQWS
Download sequence
Identical sequences G1RYT1
XP_003258916.1.23891 ENSNLEP00000018408 ENSNLEP00000018408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]