SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018416 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018416
Domain Number 1 Region: 3-219
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 
Domain Number 2 Region: 311-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000165
Family FAD/NAD-linked reductases, N-terminal and central domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018416   Gene: ENSNLEG00000015160   Transcript: ENSNLET00000019330
Sequence length 532
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:21611215:21657645:1 gene:ENSNLEG00000015160 transcript:ENSNLET00000019330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHIEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVIKCSDFA
VSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPD
IFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQ
NMLRNSLPTPIVTWLMARKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIR
PSVKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAH
LQKPTLAVIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWF
GLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGK
WEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKLFSFLALLVAIFLIFL
Download sequence
Identical sequences G1RYT9
ENSNLEP00000018416 ENSNLEP00000018416 XP_003258918.1.23891 XP_012366450.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]