SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018495 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018495
Domain Number 1 Region: 103-171
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000374
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018495
Domain Number - Region: 246-317
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000116
Family GABARAP-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018495   Gene: ENSNLEG00000015240   Transcript: ENSNLET00000019421
Sequence length 327
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:36922222:36992436:-1 gene:ENSNLEG00000015240 transcript:ENSNLET00000019421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPLPGLRSPPLPPPAAGPHGAAPLRDRVSPSCPGWSRTPELRQSACLGQPKCDYRCEDHT
QRQRLALSPRLECSGAISAHCKLRLPGSCHSPASASQRLINLSELTPYILCSICKGYLID
ATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYNIRLDRQLQDIVYKLVINLE
EREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRSKKVLESVFRIPPELDMSLLLEFIGVA
YGVLHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQYQTLREIR
RAIGDAAMQDGLLVLHYGLVVSPLKIT
Download sequence
Identical sequences ENSNLEP00000018495 ENSNLEP00000018495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]