SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018527 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018527
Domain Number 1 Region: 37-294
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.61e-37
Family Calpain large subunit, catalytic domain (domain II) 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018527
Domain Number - Region: 784-854
Classification Level Classification E-value
Superfamily Globin-like 0.000361
Family Globins 0.011
Further Details:      
 
Domain Number - Region: 627-659
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00319
Family Calpain large subunit, catalytic domain (domain II) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018527   Gene: ENSNLEG00000015247   Transcript: ENSNLET00000019455
Sequence length 1665
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:38475437:38660749:1 gene:ENSNLEG00000015247 transcript:ENSNLET00000019455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKQTKKKEVHRINSAHGSDKSKDFYPFGSNVQSGSIEQKKGKFPIWPEWSEADINSEK
WDAGKGAKEKEKTGKSPVFHFFEDPEGKIELPPSLKIYSWKRPQDILFSRTPVVVKNEIM
FDLFSANEHLLCSELMRWIISEIYAVWKIFNGGILSNYFKRTSGEPPLLPWKPWEHIYSL
CKAVKGHMPLFNSYGKYVVKLYWMGCWRKITIDDFLPFDEDNNLLLPATTYEFELWPMLL
SKAIIKLANIDIHVADRRELGEFTVIHALTGWFPEVISLHPGYMDKVWELLKEILPEFKL
SDEASSESKIAMLDSKLKEPGKEGKEGKEIKDGKEVKDVKEFKPESSLTTLKAPEKSDKV
PKEKADARDIGKKRSKDVEKEKFKFSLHGSRSSSEVQYSVQSLSDCSSAIQTSHMVVYAT
FTPLYLFENKIFSLEKMADSAEKLREYGLSHICSHPVLVTRSRSCPLVAPPKPPPVPPWK
LIRQKKETVITDEAQELIVKKPEQFLEISSPFLNYRMTPFTIPTETHFVRSLIKKGIRPG
SDLSSVSETDETATHSQTDLSQITKATSQGNTASPVILGKGTDEQTDFGLGDAHQSDRLN
LERDIVSQTTATQEKSQEELPTTNNSVSKEIWLNFEDFCVCFQNIYIFHKPSSYCLNFQK
SEFKFSEERVSYYLFVDSLKPIELLVCFSALVRWGEYGALTKDSPPIEPGLLTAETFSWK
SLKPGSLVLKIHTYATKATVVHLPVGRHMLLFNAYSPVGHSIHIYSMVSFVVGDEHVVLP
NFEPESCRFTEQSLLIMKAIGNVIANFKDKGKLSAALKDLQTAHYPVPFHDKELTAQHFR
VFHLSLWRLMKKVQITKPPPNFKFAFRAMVLDLELLNSSLEEVSLVEWLDVKYCMPTSDK
EYSPEEVAAAIKIQAMWRGTYVRLLMKARIPDTKENISVADTLQKVWAILEMNLEQYAVS
LLRLMFKSKCKSLESYPCYQDEETKIAFADYTVTYQEQPPNSWFIVFRETFLVPQDMILV
PKIYTTLPICILHVVNNDTMEQVPKVFQKVVPYLYTKNKKGYTFVVEAFTGGTYVAASRW
KLRLIGSSAPLPCLSRDSPCNTFAIKEIRDYYIPNDKKILFRYSVKVLTPQPATIQVRTS
KPDAFIKLQVLENEETMVSSTGKGQAIIPAFHFLKSEKGLSSQSSKHILSFHSASKKEQE
VYVKKKAAQGIQKSPKGRAISAIQDIGLPLLEEETTSTPTTEDSSSTPTQNYKYIIQCSV
LYNSWPLTESQLKFVQALKDLKKNNTKAYGERHEELITLGSPDSHTISSEGHKSSVTSKI
TRKGKEKSSEKEKTAKEKQAPRFEPQISTVHPQQEDPNKPYWILRLVTEHNESELFEVKK
DTERADEIRAMKQAWETTEPGRAIKASQARLHYLSGFIKKTSDAESLPISESQTKPKEEV
ETAARGVKEPNSKNSAGSESKEMTQTGSGSVAWKKWQLTKGLRDVAKSTSSESGGASSPG
KEEREQSTRKENIPTGPQTRSILETSPRLIRKALEFMDLSQYVRKTDADPLLQTDELNQQ
QAMQKAEEIHQFRQYRTRVLSIRNIDQEERLKLKDEVLDMYKEMRDSLDEARQKIFDIRE
EYRNKLLEAERLKLEALAAQEAAVKLETEKTVAPDTQKRKKGKKK
Download sequence
Identical sequences ENSNLEP00000018527 XP_003255896.1.23891 ENSNLEP00000018527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]