SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018583 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000018583
Domain Number - Region: 258-278
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0523
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018583   Gene: ENSNLEG00000015313   Transcript: ENSNLET00000019513
Sequence length 447
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:41434234:41459040:-1 gene:ENSNLEG00000015313 transcript:ENSNLET00000019513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVP
RGSCGVPDSAQRGPETALEEDFGALASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDW
FRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDD
RYIVKVAYEQDGVIGSMPGRREGQEEVKSSRWLYVVLLLPLCLFSRFMPPDDPLGRHGPS
LSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPGA
GAEEQRPPRAPGGSAARAVPREPVAHSLPPARAAGRTRPRDLLGALLSPRRPPDDPWARP
PRSDRFPGRSAWAEPAWGDGATGGLSGYAAEDDEGDARARARIALYSVFPRHQVDPVMAA
FPELSDLARLILLVQRSQSAGAPLGKP
Download sequence
Identical sequences ENSNLEP00000018583 ENSNLEP00000018583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]