SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018624 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018624
Domain Number 1 Region: 169-259
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 54-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000908
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 
Domain Number 3 Region: 279-354
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000401
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018624   Gene: ENSNLEG00000015343   Transcript: ENSNLET00000019555
Sequence length 483
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:24361421:24399514:-1 gene:ENSNLEG00000015343 transcript:ENSNLET00000019555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQDAFMEPFGDTLGVFQCKIYLLLFDIVANCLLFKFSVSSYEIWNKGACSGLKVTVPSH
TVHGVRGQALYLPVHYGFHTPASDIQIIWLFERPHTMPKYLLGSVNKSVVPDLEYQHKFT
MMPPNASLLINPLQFPDEGNYIVKVNIQGNGTLSASQKIQVTVDDPVTKPVVQIHPPSGA
VEYVGNITLTCQVEGGTRLAYQWLKNGRPVHTSSTYSFSPQNNTLHIVPVTKEDIGNYSC
LVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSYPPNT
YSWIRRTDNTTYIIKHGPRLEVASEKVAQKTTDYVCCAYNNITGRQDETHFTVIITSVGL
EKLAQKGKSLSPLASITGISLFLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQTF
SGHEDALDDFGIYEFVAFPDASGVSKIPSRSIPASDGVSGQDLHSTVYEVIQHIPAQQQD
HPE
Download sequence
Identical sequences ENSNLEP00000018624 ENSNLEP00000018624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]