SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018631 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018631
Domain Number 1 Region: 29-202
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.71e-52
Family MHC antigen-recognition domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018631   Gene: ENSNLEG00000015350   Transcript: ENSNLET00000019562
Sequence length 263
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:41884994:41887473:-1 gene:ENSNLEG00000015350 transcript:ENSNLET00000019562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRMSLTSSPVCLFLLLLLQLIALEIMVGAHSLCFNFTIKSWSRPGQPWCEAQVFMNKIL
FLQYDSDNNMVKPLGLLGKKVNATSTRGELTQTLGEVGRDLRMLLLDIKPQTKTSGPSTL
QVEMFCQREAEQCTGASWQFAINGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKY
FRKLSKGDCDQWLSEFLGHWEAMPEPTVSPVNASDIHWSSSSLPDTWIILGAFILLVLMG
IVVIYVRWQNGEWQAGLWPLRTS
Download sequence
Identical sequences G1RZF4
ENSNLEP00000018631 ENSNLEP00000018631 XP_003255919.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]