SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018635 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018635
Domain Number 1 Region: 29-204
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 8.47e-51
Family MHC antigen-recognition domain 0.00000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018635   Gene: ENSNLEG00000015354   Transcript: ENSNLET00000019566
Sequence length 244
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:41935122:41940581:1 gene:ENSNLEG00000015354 transcript:ENSNLET00000019566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAASPAFLLCLPLLHLLSGWSRAGRADTHCLCYDFIITPKFRPEPQWCEVQGLVDERP
FLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLT
LQARMSCEHEAHGHGRGSWQFLSNGHKFLLFDSNNRKWTVLHPGAKKMKEKWEKNREVIV
FFQKVSMGDCKMWLEEFLTYWEQMLDPTKPPSLTPGTTEPKAMATTLSPWGLLIIFLCFI
LAGR
Download sequence
Identical sequences G1RZF8
ENSNLEP00000018635 XP_003255921.1.23891 ENSNLEP00000018635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]