SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018645 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018645
Domain Number 1 Region: 30-206
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.3e-51
Family MHC antigen-recognition domain 0.0000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018645   Gene: ENSNLEG00000015356   Transcript: ENSNLET00000019576
Sequence length 243
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:42006589:42011030:-1 gene:ENSNLEG00000015356 transcript:ENSNLET00000019576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAASPASLLLLAILPHLLFDWSGTGRADAHSLWYNFTIIHLPRHGQRWCEVQSQVDQK
NFLSYDCGSDKILSMGHLEEQLDATDAWGKQLEMLRDVGQRLRLELADTEKEDFPPSGPL
TLQARMSCECEADGCIRGSWQFSFDGQKFLLFDSDNGKWTAVQDGARRLKEKWEKDSGLT
MFFKMVSRDCKSWLRYFLMHRKKRLEPTAPPTVAPGLAQPKAKATTLSPWSYLIILCFIL
PGI
Download sequence
Identical sequences G1RZG8
ENSNLEP00000018645 XP_012361463.1.23891 ENSNLEP00000018645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]