SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018653 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018653
Domain Number 1 Region: 1069-1163
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-23
Family I set domains 0.0026
Further Details:      
 
Domain Number 2 Region: 781-874
Classification Level Classification E-value
Superfamily Immunoglobulin 2.89e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 877-971
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-21
Family I set domains 0.0076
Further Details:      
 
Domain Number 4 Region: 129-223
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 1165-1252
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-19
Family I set domains 0.0066
Further Details:      
 
Domain Number 6 Region: 973-1067
Classification Level Classification E-value
Superfamily Immunoglobulin 2.75e-19
Family I set domains 0.0032
Further Details:      
 
Domain Number 7 Region: 418-505
Classification Level Classification E-value
Superfamily Immunoglobulin 8.18e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 320-415
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 9 Region: 224-318
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-16
Family I set domains 0.0098
Further Details:      
 
Domain Number 10 Region: 688-778
Classification Level Classification E-value
Superfamily Immunoglobulin 3.25e-16
Family I set domains 0.005
Further Details:      
 
Domain Number 11 Region: 36-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000296
Family I set domains 0.0082
Further Details:      
 
Domain Number 12 Region: 594-685
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000317
Family I set domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018653   Gene: ENSNLEG00000015346   Transcript: ENSNLET00000019585
Sequence length 1341
Comment pep:known_by_projection supercontig:Nleu1.0:GL397286.1:26535146:26551045:-1 gene:ENSNLEG00000015346 transcript:ENSNLET00000019585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRPGEGATMLKTFPVLLFCIRMSLGMTSIVTDPQPELWIESNYPQAPWENITLWCRS
PSRISSKFLLLKDKIQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKV
LELEAPGQLPKPIFWIQAETPPLPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGT
MAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAYPGPIMAP
GESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFRSLKIQDTGHYLCFYYD
ASYRGSLLSDVLKIWVTDTFPKTWLLARPRAVVQMGQNVSLWCRGPVDGVGLALYKKGED
KPLQFLDATSIDDNTSFFLSNVTYSDTGIYSCHYLLTWKTSIRMPSHNTVELMVVDKPPK
PSLSAWPSTVFKLGKAITLQCRVSHPVLEFSLEWEERETFQKFSVNGDFIISNVDGKGTG
TYSCSYRVETHPNIWSHRSEPLKLMGPAGYLTWNYILNEAIRLSLIMQLVALLLVVLWIR
WKCRRLRIREAWLLGTAQGVTMLFIVTALLCCAISFAGLCNGVLIEETEIVMPTPKPELW
AETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHT
GSYHCHSWEEMAVSEPSEALELVGTDILPKPVISATPPIRGQELQLRCKGWLAGMGFALY
KEGEQEPVQQLGAVGREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEM
YPKPFFKTWASPVVTPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFL
IISVGIGDGGNYSCRYYDFSIWSEPSDPVELVVTEFYPKPTLLAQPGPVVFPGKSVTLRC
QGTFQGMRFALLQEGAHVPLQFRSVSGNSADFILHTVGAEDSGNYSCIYYETTMSNRGSY
LSMPLMIWVTDTFPKPWLFAEPSSVVPMGQNVTLWCRGPVHGVGYILHKEGEATSMQLWG
STSNDGAFPITNISGASMGRYSCCYHPDWTSSIKIQPSNTLELIVTGLLPKPSLLAQPGP
IVAPGENMTLQCQGELPDSTFVLLKEGAQEPLEQQRPSGKRADFWMPAVRGEDSGIYSCV
YYLDSAPFAASNHSDSLEIWVTDKPPKPSLSAWPSTMFKLGKDITLQCRGPLPGVEFVLE
HDGEEAPQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDPLELVGAAGPVAQ
ECTVGNIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGEPG
TPANSSSSTSRRISVELPVPI
Download sequence
Identical sequences G1RZH6
XP_012354605.1.23891 ENSNLEP00000018653 ENSNLEP00000018653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]