SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018673 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018673
Domain Number 1 Region: 247-554
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.29e-107
Family Transglutaminase core 0.0000000409
Further Details:      
 
Domain Number 2 Region: 99-246
Classification Level Classification E-value
Superfamily E set domains 1.75e-44
Family Transglutaminase N-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 568-679
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.13e-29
Family Transglutaminase, two C-terminal domains 0.00049
Further Details:      
 
Domain Number 4 Region: 680-779
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.09e-29
Family Transglutaminase, two C-terminal domains 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018673   Gene: ENSNLEG00000015377   Transcript: ENSNLET00000019607
Sequence length 808
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:3390194:3403746:-1 gene:ENSNLEG00000015377 transcript:ENSNLET00000019607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPEPDRRSRRGGGGRSFWARCCGCCSCRNAV
DDDWGPEPSDSRGRGSSSGTRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLSSRSDQNRR
QHHTEEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGK
GGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEIYILF
NPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDR
RGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGTGSGDYSRAPTHQRGGQREILLSYLRG
LFRPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNH
DSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKY
DTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIGSNMREDITYLYKHPEG
SDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLTNHSSSRRT
VKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNV
SGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLE
GSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPA
PGDRGFFSDAGGDSHLGETIPMASRGGA
Download sequence
Identical sequences G1RZJ6
ENSNLEP00000018673 XP_003260733.1.23891 ENSNLEP00000018673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]