SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018682 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018682
Domain Number 1 Region: 1057-1277
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.01e-81
Family Fibrinogen C-terminal domain-like 0.00000158
Further Details:      
 
Domain Number 2 Region: 798-963
Classification Level Classification E-value
Superfamily Fibronectin type III 1.49e-21
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 3 Region: 622-787
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-21
Family Fibronectin type III 0.00085
Further Details:      
 
Domain Number 4 Region: 444-608
Classification Level Classification E-value
Superfamily Fibronectin type III 3.69e-21
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 264-425
Classification Level Classification E-value
Superfamily Fibronectin type III 5.71e-18
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 6 Region: 971-1059
Classification Level Classification E-value
Superfamily Fibronectin type III 7.62e-16
Family Fibronectin type III 0.00084
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018682
Domain Number - Region: 237-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 174-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 205-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.017
Family Integrin beta EGF-like domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018682   Gene: ENSNLEG00000015376   Transcript: ENSNLET00000019617
Sequence length 1299
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:25634172:25707362:1 gene:ENSNLEG00000015376 transcript:ENSNLET00000019617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQEMFHFPLGLLLGSVLLVASAPATLEPPGCSNKEQQVTVSHTYKIDVPKSALVQVDG
DPQPLSDDGASLLALGEAGEEQNIIFRHNIRLQTPQKDCELAGSIQDLLARVKKLEEEMV
EMKEQCSAQRCCQGVTDLSRHCSGHGTFSLETCSCHCEEGREGPACEQLACPGACSGHGR
CVDGRCLCHEPYVGADCGYPACPENCSGHGECVRGMCQCHEDFMSEDCSEKRCPGDCSGH
GFCDTGECYCEEGFTGLDCAQVVAPQGLQLLKNTEDSLLVSWEPSSQVDHYLLSYYPLGK
ELSGKQIHVPKEQHSYEILGLLPGTKYIVTLRNVKKEVSSSPQHLLATTDLAVLGTAWVT
DETENSLDVEWENPSTEVDYYKLRYGPMTGQEVAEVTVPKSSDPKSRYDITGLHPGTEYK
ITVVPMRGELEGKPILLNGRTEIDSPTNVVTDRVTEDTATVSWDPVQAVIDKYVVRYTSA
DGDTKEMAVHKDESSTVLTGLKPGEAYKVYVWAERGNQGSKKADTNALTEIDSPANLVTD
QVTENTATISWDPVQATIDTYVVHYTSADDQETREVLVGKEQSSTVLTGLRPGVEYTVHV
WAQKGDRESKKTDTNAPTDIDSPQNLVTDRVTENMATVSWDPVQAAIDKYVVRYTSADGE
TREVPVGKEQSSTVLTGLRPGMEYTVHVWAQKGDQESKKADTKAQTDIDSPQNLVTDRVT
ENMATVSWDPVQATIDRYVVRYTSAKDGETREFPVGKEQSSTVLTGLRPGVEYTVHVWAQ
KGAQESKKADTKAQTDIDSPQNLVTDRVTENTAIVSWDPVQATIDRYVVRYTSANGETRE
VPVGKEQSSTVLTGLRPGVEYTVHVWAQKGNQESKKADTKAQTEIDSPQNLVTDRVTENM
ATVSWDPVQATIDKYVVRYTSADGETREVPVGKEHSSTVLTGLRPGMEYMVHVWAQKGAQ
ESKKADTKAQTELDPPRNLHPSAVTQSGGVLTWTPPSAQIHGYILTYQFPDGTVKEMQLG
REDQRFELQGLEQGATYPVSLVAFKGSRRSRNVTTTLSTVGARFPHPSDCSQVQQNSNAA
SGLYTIYLHGDASRPLQVYCDMDTDGGGWIVFQRRNTGQLDFFKRWRSYVEGFGDPMKEF
WLGLDKLHNLTTGTPTRYEVRVDLQTANESAYAIYDFFQVASSKERYKLTVGKYRGTAGD
ALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSEGVNWEPW
KGHEFSIPYVELKIRPHVYSREPVLGRKKRTLGGRLRTF
Download sequence
Identical sequences G1RZK5
XP_003258967.1.23891 ENSNLEP00000018682 ENSNLEP00000018682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]