SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018695 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018695
Domain Number 1 Region: 21-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-27
Family V set domains (antibody variable domain-like) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018695   Gene: ENSNLEG00000015413   Transcript: ENSNLET00000019633
Sequence length 145
Comment pep:known_by_projection supercontig:Nleu1.0:GL397584.1:229191:229917:-1 gene:ENSNLEG00000015413 transcript:ENSNLET00000019633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWAPVLLMLLVYCTGCGPQPVLHQPPAMSSAPGTTIRLTCTLRNDHDIRVYSVYWYQQK
PGHSPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRWYLSISELQPEDEAMYYCAMGAR
SLEKKEREREWEEEMEPTAAGTRVP
Download sequence
Identical sequences G1RZL8
XP_003281900.1.23891 ENSNLEP00000018695 ENSNLEP00000018695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]