SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018701 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018701
Domain Number 1 Region: 280-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-54
Family SPRY domain 0.000019
Further Details:      
 
Domain Number 2 Region: 22-131
Classification Level Classification E-value
Superfamily Immunoglobulin 1e-17
Family V set domains (antibody variable domain-like) 0.00013
Further Details:      
 
Domain Number 3 Region: 140-220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000251
Family I set domains 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018701   Gene: ENSNLEG00000015403   Transcript: ENSNLET00000019639
Sequence length 500
Comment pep:known_by_projection supercontig:Nleu1.0:GL397646.1:189067:233750:1 gene:ENSNLEG00000015403 transcript:ENSNLET00000019639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALMLSLVLSLLKLGSGQWLVFGPGKPVQALVGEDAAFSCFLSPKTNAEAMEVQFFRGQF
PSVVHLYRDRKDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQS
YYHEAIWELQVSALGSVPLISIAGYVDGGIQLLCRSSGWFPRPTAKWKGPQGQDLSTDSR
TNTDMHGLFDVEISLTVQENAGSISCSMQHAHLSREVESRVQIGDTFFQPTSLHLATKVL
GILCCGLFFGIVGLKIFFSKFQGKIQAELGWTGSTGRGELRDARKHAVEVTLDPETAHPQ
LCVSDLKTVTHRKAPQDMPHSEKRFTRKSVVASQSFQAGKHYWEVDGGHNERWRVGVCRD
DVDRRKQHVPLSPDHGYWVLRLNGGHLYFTLNPRFISLIPRTPPTQIGVFLDYECGTISF
FNINDQSLIYTLTCQFEGLLRPYIEYPSHNGQDGTPVVICPVTQESEREASWQKASTIPE
TSNSESSSQATMPFLPRGDV
Download sequence
Identical sequences ENSNLEP00000018701 ENSNLEP00000018701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]