SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018706 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018706
Domain Number 1 Region: 1124-1343
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.31e-84
Family Fibrinogen C-terminal domain-like 0.000000879
Further Details:      
 
Domain Number 2 Region: 593-766
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-24
Family Fibronectin type III 0.0000107
Further Details:      
 
Domain Number 3 Region: 953-1121
Classification Level Classification E-value
Superfamily Fibronectin type III 3.16e-22
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 776-934
Classification Level Classification E-value
Superfamily Fibronectin type III 7.43e-21
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 5 Region: 414-595
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-19
Family Fibronectin type III 0.0000065
Further Details:      
 
Domain Number 6 Region: 328-411
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000698
Family Fibronectin type III 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018706
Domain Number - Region: 300-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000178
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 208-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 239-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 270-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.009
Family Integrin beta EGF-like domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018706   Gene: ENSNLEG00000015398   Transcript: ENSNLET00000019644
Sequence length 1356
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:25877025:26321186:-1 gene:ENSNLEG00000015398 transcript:ENSNLET00000019644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGADGETVVLKNMLIGVNLILLGSMIKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKE
QPVVFNHVYNINVPLDSLCSLGLEASAEQEVSAEDDTLAEYTGQTSDRESQVTFTHRINL
PKKACPCASSAQVLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCVCEEGYQGPDCSAVAPPEDRVAGISDRSIELEWDGPMAVTEYVISYQP
TALGGLQLQQRVPGDWSGVTITELEQVSYNISVYAVISNILSLPITAKVATHLSTPQGLQ
FKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEYIV
NVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGLVG
GEGGRTTFRLQPPLSQYSVQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNLRV
GSRTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHEVLVPKGIGPTTRATLTDLVPGTEY
GVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSETSISLFWTKASGPIDHYRITFTP
SSGIASEVTVPKDRTSYTLTDLEPGSEYIISITAERGRQQSLESTVDAFTGFRPISHLHF
SHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHAVLMGLQPATEYIV
NLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRPTQ
VGRLDSSVVPNTVTEFTITRLYPATEYEISLNSVRGREESERICTLVHTAMDNPVDLIAT
NITPTEALLQWKAPVGEVENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTATMY
ATNGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYVLTYKSTDGSR
KELIVDAEDTWIRLEGLLENTHYTVLLQAAQDTAWSSITSTAFTTGGRVFPHPQDCAQHL
MNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVGFG
NLEDEFWLGLDNIQRITSQGRYELRVDMRDGQEAAFASYDRFSVEDSRNLYKLRIGSYNG
TAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQGIN
WYHWKGHEFSIPFVEMKMRPYSHRLMAGRKRQSLQF
Download sequence
Identical sequences ENSNLEP00000018706 ENSNLEP00000018706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]