SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018727 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018727
Domain Number 1 Region: 33-88
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0000859
Further Details:      
 
Domain Number 2 Region: 154-209
Classification Level Classification E-value
Superfamily BPTI-like 9.79e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0015
Further Details:      
 
Domain Number 3 Region: 91-152
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000639
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018727   Gene: ENSNLEG00000015399   Transcript: ENSNLET00000019667
Sequence length 235
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:25085750:25091744:-1 gene:ENSNLEG00000015399 transcript:ENSNLET00000019667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPARPLGLSILLLLLMEAALGDAAQEPTGNNAEICLLPLDYGPCQALLPRYYYDRYTQS
CRQFLYGGCEGNANNFYTWEACDEACWRIEKVPKVCRLQVSVDDHCEGSTEKYFFNLSSM
TCEKFLSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRY
RTCDAFTYTGCGGNDNNFVSREDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF
Download sequence
Identical sequences A0A2I3GRA7
ENSNLEP00000018727 XP_003252545.1.23891 XP_012365832.1.23891 ENSNLEP00000018727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]