SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018742 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018742
Domain Number 1 Region: 23-127
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-37
Family V set domains (antibody variable domain-like) 0.0000298
Further Details:      
 
Domain Number 2 Region: 129-226
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-29
Family C1 set domains (antibody constant domain-like) 0.00000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018742   Gene: ENSNLEG00000027025   Transcript: ENSNLET00000019683
Sequence length 233
Comment pep:known_by_projection supercontig:Nleu1.0:GL397509.1:374238:450050:1 gene:ENSNLEG00000027025 transcript:ENSNLET00000019683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWTPLLLPLLTFCTGSVASYELTQPPSVSVSPGQTAKITCSGDALPKKYAYWYQQKSGQ
TPVLIIYEDSKRPSGIPERFSGSSSGTMATLTISGTQVEDEADYYCYSADSSGNHWVFGE
GTKLTILGQPKVAPLVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGV
ETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPAECS
Download sequence
Identical sequences ENSNLEP00000018742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]