SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018751 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018751
Domain Number 1 Region: 529-730
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-40
Family Fibronectin type III 0.0000522
Further Details:      
 
Domain Number 2 Region: 1137-1332
Classification Level Classification E-value
Superfamily Fibronectin type III 1.97e-38
Family Fibronectin type III 0.0000191
Further Details:      
 
Domain Number 3 Region: 929-1137
Classification Level Classification E-value
Superfamily Fibronectin type III 1.59e-34
Family Fibronectin type III 0.0000181
Further Details:      
 
Domain Number 4 Region: 1661-1856
Classification Level Classification E-value
Superfamily Fibronectin type III 1.95e-33
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 5 Region: 1336-1481
Classification Level Classification E-value
Superfamily Fibronectin type III 4.15e-29
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 1513-1662
Classification Level Classification E-value
Superfamily Fibronectin type III 3.42e-28
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 7 Region: 730-888
Classification Level Classification E-value
Superfamily Fibronectin type III 8.93e-27
Family Fibronectin type III 0.00014
Further Details:      
 
Domain Number 8 Region: 340-432
Classification Level Classification E-value
Superfamily Immunoglobulin 9.03e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 9 Region: 239-338
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 10 Region: 438-534
Classification Level Classification E-value
Superfamily Immunoglobulin 6.83e-18
Family I set domains 0.023
Further Details:      
 
Domain Number 11 Region: 153-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000225
Family I set domains 0.024
Further Details:      
 
Domain Number 12 Region: 58-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000238
Family I set domains 0.048
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018751
Domain Number - Region: 2-49
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000198
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018751   Gene: ENSNLEG00000015435   Transcript: ENSNLET00000019692
Sequence length 2073
Comment pep:known_by_projection supercontig:Nleu1.0:GL397424.1:507240:1259726:1 gene:ENSNLEG00000015435 transcript:ENSNLET00000019692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHNDSELTTYSSEYKYIIPSLQKLDAGFYRCVVRNRMGALLQRKSEVQVAYMGSFMDTDQ
RKTVSQGRAAILNLLPITSYPRPQVTWFREGHKIIPSNRIAITLENQLVILATTTSDSGA
YYVQAVNEKNGENKTSPFIHLSIARDVGTPETMAPTIVVPPGNRSVVAGSSETTLECIAN
ARPVEDLSVTWKRNGVRITSGLHSFGRRLTISNPTSADTGPYVCEAALRGGAFEPARAKA
FLFIIEPPYFTAEPESRISAEVEETVDIGCQAMGVPLPTLQWYKDAISISRLQNPRYKVL
ASGGLRIQKLSPEDSGIFQCFASNEGGEIQTHTYLDVTNIAPVFTQRPVDTTVTDGMTAI
LRCEVSGAPKPAITWKRENHILASGSVRIPRFMLLESGGLQIAPVFIQDAGNYTCYAANT
EGSLNASAMLTVWNRTSIIHPPEDHVVIKGTTATLHCGATHDPRVSLRYVWKKDNVALTP
SSTSRIVVEKDGSLLISQTWSGDIGDYTCEIVSEGGNDSRMARLEVIELPHSPQNLLASP
KSSHSHAVVLSWVRPFDGNSPILYYVVELSENNSPWKVHLSNVGPEMTGVTVSGLTPART
YQFRVCAVNEVGRGQYSAETSRLMLPEEPPSAPPKNIVASGRTNQSIMVQWQPPPETEHN
GVLRGYILYRLAGLPGEYQQRNITSPEVNYCLVTDLIIWTQYEIQVAAYNGAGLGVFSRA
VTEYTLQGVPTAPPQNVQTEAVNSTTIQFLWNPPPQQFINGINQGYKLLAWLADAPEAVT
VVTIAPDFHGVHHGHITNLKKFTAYFTSVLCFTTPGDGPPSTPQLVWTHEDKPGAVGHLS
FTEILDTSLKVSWQEPLEKNGIITGYQISWEVYGRNDSRLTHTLNSTTHDYERKYGLLVL
CVFLIREAMLTMSVTVCKSLPFLPGSSLDLPGAPSNLVISNISPRSATLQFRPGYDGKTS
ISRWIVEGQVGAIGDEEEWVTLYEEENEPDAQTLEIPNLTPYTHYRFRMKQVNIVGPSPY
SQSSRVIQTLQAPPDVAPTSVTVRTASETSLRLRWVPLQDSQYNGNPESVGYRIKYWRSD
LQSSALAQVVSDRLEREFTIEELEEWMEYELQMQAFNAVGAGPWSEVVRGRTRESVPSAA
PENVSAEAVSSTQILLTWASVPEQDQNGLILGYKILFRAKDLDPEPRSHIVRGNHTQSAL
LAGLRKFVLYELQVLAFTRIGNGVPSTPLILERTKDDAPGPPVRLVFPEVRLTSVRIVWQ
PPEEPNGIILGYQIYRLASSSPHTFTTVEVGATVRQFTATDLAPESAYIFRLSAKTRQGW
GEPLEATVITTEKRERPAPPRELLVPQAEVTARSLQLQWVPGSDGASPIRYFTVQVRELP
RGEWQTYSSSISHEATACVVDRLRPFTSYKLRLKATNDIGDSDFSSETEAVTTLQDVPGE
PPGSVSATPHTTSSVLIQWQPPRDESLNGLLQGYRIYYRELEYEAGSGTEAKTLKSPIAL
RAELTAQSSFKTVNSSSTSTMCELTHLKKYRRYEVIMTAYNIIGESPASAPVEVFVGEAA
PAMAPQNVQVTPLTASQLEVTWDPPPPESQNGNIQGYKARALPCDSQNETEKMKVLFLPE
PVVKLKNLTSHTKYLVSISAFNAAGDGPRSDPQQGRTHQAAPGAPSFLAFSEITSTTLNV
SWGEPAAANGILQGYRVVYEPLAPVQGVSKVVTVEVRGNWQRWLKVRDLTKGVTYFFRVQ
ARTITFGPELQANITAGPAEGSPGSPRDVLVTKSASELTLQWTEGHSGDTPTTGYVIEAR
PSDEGLWDMFVKDIPRSATSYTLSLAKLRQGVTYEFRVVAVNEAGYGEPSSPSTAVSAQV
EAPFYEEWWFLLVMALSSLIVILLVVFALVLHGQNKKYKNCSTGKGISTMEESVTLDNGG
FAALELSSRHLNVKSTFSKKNGTRSPPRPSPGGLHYSDEDICNKYNGAVLTESVSLKEKS
ADASESEATDSDYEDALPKHSFVNHYMSDPTYYNSWKRRAQGRAPAPHRYEAVAGAEAGA
QLHPVITTQSAGGVYTPAGPGARTPLTGFSSFV
Download sequence
Identical sequences ENSNLEP00000018751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]