SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018753 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018753
Domain Number 1 Region: 704-992
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.7e-56
Family Protein kinases, catalytic subunit 0.00000222
Further Details:      
 
Domain Number 2 Region: 91-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000949
Family MAM domain 0.037
Further Details:      
 
Domain Number 3 Region: 52-85
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000137
Family LDL receptor-like module 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018753   Gene: ENSNLEG00000015414   Transcript: ENSNLET00000019694
Sequence length 1225
Comment pep:known_by_projection supercontig:Nleu1.0:GL397288.1:8797452:8990235:-1 gene:ENSNLEG00000015414 transcript:ENSNLET00000019694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWN
GTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWTQGTLSPHTPQWQVRT
LKDARFQDHRDHALLLSTTDVPTSESATVTSATFPAPIKSSPYELRMSWLIRGVLRGNVS
LVLVENKTGKEQGRMVWHVAAYEGLNLWQWTVLPLLDVSERFWLQMVAWWGQGSRAIVAF
DNISISLDCYLTISGEDKILQNTAPKSRNLFERNPNKELKPGETSPRQTPIFDPTVHWLF
TTCGASGPHGPHPGALSNTCKAAPSVMELGFEPRVLWLKVSPIPTTSFCFISGYGAAGGK
GGKNTMMRSHGVSVLGIFNLEKDDTLYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEI
RVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTDTFHPERLENNS
SVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGGGG
GGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHYL
NCSHCEVDECHMDPESHQVICFCDHGTVLAEDGISCIVSPTPEPHLPLSLILSVVTSALV
ASCHVAADHPSAVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSI
SDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKVRSLALEPALGLLTL
SGLGPRHPNSFKCLQVTSNVQPGPMPLISLLSLTSSSSVAHFCLPTSQPSSLAMLDLLHV
ARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCA
MLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMD
PPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLAEEEE
KVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAGVSVRVPRGP
AMEGGHVNMAFSQSNPPSELHKVQGSRNKPTSLWNPTYGSWFTEKPTKKKEPHERGNLGL
EGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEA
ATAPGAGHYEDTILKSKNSMNQPGP
Download sequence
Identical sequences ENSNLEP00000018753 ENSNLEP00000018753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]