SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018773 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018773
Domain Number 1 Region: 673-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000159
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Domain Number 2 Region: 725-759
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000216
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 3 Region: 323-352
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000647
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018773
Domain Number - Region: 596-628
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000126
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 452-483
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00196
Family CCCH zinc finger 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018773   Gene: ENSNLEG00000015470   Transcript: ENSNLET00000019715
Sequence length 818
Comment pep:known_by_projection supercontig:Nleu1.0:GL397297.1:21205546:21231991:1 gene:ENSNLEG00000015470 transcript:ENSNLET00000019715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QELETFSLLSNGTAAGVADQGTSNGLGSIDDIETGNVPDTRQVEIGAPADCYVDPRGSPA
FLPSTPTMPLFPHVLDLLAPLDSSRTLPSTESLDDFSDGDVFGPELDTLLDSLSLVQGGL
SGSGVPSELPQLIPVFPGGTPLLPPVVGGSIPVSSPLPPASFGLVMDPSKKLAASVLDAL
DPPGPTLDPLDLLPYSETRLDALDSFGSTRGSLDKPDSFMEETNSQDHRPPSGAQKPAPS
PEPCMPNTALLIKNPLAATHEFKQACQLCYPKTGPRAGDYTYREGLEHKCKRDILLGRLR
SSEDQTWKRIRPRPTKTSFVGSYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGT
LNRDLLFDPLGGVKRGSLTIAKLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNL
AAKHSFYNNKCLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIE
LKVWLLQQYSGMTHEDIVQESKKYWQQMEAHAGKASSSMGAPRTHGPSTFDLQMKFVCGQ
CWRNGQVVEPDKDLKYCSAKARHCWTKERRVLLVMSKAKRKWVSVRPLPSIRNFPQQYDL
CIHAQNGRKCQYVGNCSFAHSPEERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTP
ISSREGEKQIQMPTDYADIMMGYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDTSG
WAFRFPMGEFRLCDRLQKGKACPDGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLL
CPRDDDFGKYNFLLQEDGDPAGATPEAPAAAATATTGE
Download sequence
Identical sequences ENSNLEP00000018773 ENSNLEP00000018773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]