SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018775 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018775
Domain Number 1 Region: 658-696
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000159
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Domain Number 2 Region: 710-744
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000173
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 3 Region: 308-337
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000518
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018775
Domain Number - Region: 581-613
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000124
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 437-468
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00157
Family CCCH zinc finger 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018775   Gene: ENSNLEG00000015470   Transcript: ENSNLET00000019717
Sequence length 803
Comment pep:known_by_projection supercontig:Nleu1.0:GL397297.1:21205546:21231991:1 gene:ENSNLEG00000015470 transcript:ENSNLET00000019717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QELETFSLLSNGTAAGVADQGTSNGLGSIDDIETDCYVDPRGSPAFLPSTPTMPLFPHVL
DLLAPLDSSRTLPSTESLDDFSDGDVFGPELDTLLDSLSLVQGGLSGSGVPSELPQLIPV
FPGGTPLLPPVVGGSIPVSSPLPPASFGLVMDPSKKLAASVLDALDPPGPTLDPLDLLPY
SETRLDALDSFGSTRGSLDKPDSFMEETNSQDHRPPSGAQKPAPSPEPCMPNTALLIKNP
LAATHEFKQACQLCYPKTGPRAGDYTYREGLEHKCKRDILLGRLRSSEDQTWKRIRPRPT
KTSFVGSYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDLLFDPLGGVKR
GSLTIAKLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHSFYNNKCLVHI
VRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWLLQQYSGMTHE
DIVQESKKYWQQMEAHAGKASSSMGAPRTHGPSTFDLQMKFVCGQCWRNGQVVEPDKDLK
YCSAKARHCWTKERRVLLVMSKAKRKWVSVRPLPSIRNFPQQYDLCIHAQNGRKCQYVGN
CSFAHSPEERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTD
YADIMMGYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDTSGWAFRFPMGEFRLCDR
LQKGKACPDGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCPRDDDFGKYNFLLQ
EDGDPAGATPEAPAAAATATTGE
Download sequence
Identical sequences ENSNLEP00000018775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]