SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018779 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018779
Domain Number 1 Region: 157-226
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000115
Family VWC domain 0.018
Further Details:      
 
Domain Number 2 Region: 284-359
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000199
Family VWC domain 0.018
Further Details:      
 
Domain Number 3 Region: 626-683
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000621
Family BSTI 0.047
Further Details:      
 
Domain Number 4 Region: 99-165
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000335
Family VWC domain 0.0059
Further Details:      
 
Domain Number 5 Region: 62-106
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000565
Family VWC domain 0.044
Further Details:      
 
Domain Number 6 Region: 236-290
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000272
Family VWC domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018779   Gene: ENSNLEG00000015455   Transcript: ENSNLET00000019721
Sequence length 685
Comment pep:known_by_projection supercontig:Nleu1.0:GL397454.1:1011010:1256587:1 gene:ENSNLEG00000015455 transcript:ENSNLET00000019721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWFSGVGAVAERYCRRSPGITCCVLLLLNCSGFPMSLASSFLTGSVAKCENEGEVLQIP
FITDNPCIMCVCLNKEVTCKREKCPVLSRDCALAVKQRGACCEQCKGCTYEGNTYNSSFK
WQSPAEPCVLRQCQEGVVTESEMRCVVHCKNPLEHLGMCCPTCPGCVFEGVQYQEGEEFQ
PEGSKCTKCSCTGGRTQCVREVCPILSCPQHLSHIPPGQCCPKCLGQRKVFDLPFGSCLF
RSDVYDNGSSFLYDNCTACTCRDSTVVCKKKCSHPGVCDQGQEGCCEECLLRVPPEDIKV
CKFGNKIFRDGEMWSSINCTICACVKGRTECRNKQCIPISSCPQGKILNRKGCCPICTEK
PGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKS
VELVLGESRVSLQQHLTVRWNGSRIALPCRAPHFHIDLDGYLLKVTTKAGLEISWDGDSF
VEVMAAPHLKGKLCGLCGNYNGHKRDDLFGGDGNFKFDVDDFAESWRVESNEFCNRPQRK
PVPELCQGTVKVKLRAHRECQKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCE
SFLAYTRACQREGIKVHWEPQQNCAATQCKHGAVYDTCGPGCIKTCDNWNEIGPCNKPCV
AGCHCPANLVLHKGRCIKPVLCPQR
Download sequence
Identical sequences G1RZV2
ENSNLEP00000018779 ENSNLEP00000018779 XP_003279242.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]