SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018783 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000018783
Domain Number - Region: 19-76
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0133
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018783   Gene: ENSNLEG00000015481   Transcript: ENSNLET00000019725
Sequence length 81
Comment pep:known_by_projection supercontig:Nleu1.0:GL397297.1:21341486:21342690:-1 gene:ENSNLEG00000015481 transcript:ENSNLET00000019725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI
CGGPGVSDAYYCKECTIQEKD
Download sequence
Identical sequences B7PHP4 G1MB16 G1RZV6
XP_002403364.1.51680 ENSNLEP00000018783 ENSAMEP00000016543 ENSNLEP00000018783 ENSAMEP00000016543 ISCW018236-PA 6945.ISCW018236-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]