SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018795 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018795
Domain Number 1 Region: 933-982,1010-1061
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000134
Family Fibronectin type III 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018795
Domain Number - Region: 376-415,519-622
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000204
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018795   Gene: ENSNLEG00000015484   Transcript: ENSNLET00000019738
Sequence length 1210
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:27438742:27648944:-1 gene:ENSNLEG00000015484 transcript:ENSNLET00000019738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLEISGNTEDIPLVRWRQQWLENGTLLFHIHHQDGAPSLPGQDPTEEPQHESAEEELRIL
HISVMGGMIALLLSILCLVMILYTRRRWCKRRRVPQPQKSASAEAANEIHYIPSVLIGGH
GRESLRNARVQGHNSSGTLSIRETPILDGYEYDITDLRHHLQRECMNGGEDFASQVTRTL
DSLQGCNEKSGMDLTPGSDNAKLSLMNKYKDNIIATSPVDSNHQQATLLSHTSSSQRKRI
NNKARAGSAFLNPEGDSGTEAENDPQLTFYTDPSRSRRRSRVGSPRSPVNKTTLTLISIT
SCVIGLVCSSHVNCPLVVKITLHVPEHLIADGSRFILLEGSQLDASDWLNPAQVVLFSQQ
NSSGPWAMDLCARRLLDPCEHQCDPETGRQEHRAAGECLCYEGYMKDPVHKHLCIRNEWG
TNQGPWPYTIFQRGFDLVLGEQPSDKIFRFTYTLGEGMWLPLSKSFVIPPAELAINPSAK
CKTDMTVMEDAVEVREELMTSSSFDSLEVLLDSFGPVRDCSKDNGGCSKNFRCISDRKLD
STGCVCPSGLSPMKDSSGCYDRHIGVDCSDGFNGGCEQLCLQQMAPFPDDPTLYNILMFC
GCIEDYKLGVDGRSCQLITETCPEGSDCGESRELPMNQTLFGEMFFGYNNHSKEVAAGQV
LKGTFRQNNFARGLDQQLPDGLVVATVPLENQCLEEISEPTPDPDFLTGMVNFSEVSGYP
VLQHWKVRSVMYHIKLNQVAISQALSNALHSLDGATSRADFVALLDQFGNHYIQEAIYGF
EESCSIWYPNKQVQRRLWLEYEDISKGNSPSDESEERERDPKVLTFPEYIASLSDSGTKR
MAAGVRMECQSKGRCPSSCPLCHVTSSPDTPAEPVLLEVTKAAPIYELVTNNQTQRLLQE
ATMSSLWCSGTGDVIEDWCRCDSTAFGADGLPTCAPLPQPVLRLSTVHEPSSTLVVLEWE
HSEPPIGVQIVDYLLRQEKVTDRMDHSKVETETVLSFVDDIISGAKSPCAMPSQVPDKQL
TTISLIIRCLEPDTIYMFTLWGVDNTGRRSRPSDVIVKTPCPVVDDVKAQEIADKIYNLF
NGYTSGKEQQTAYNTLLDLGSPTLHRVLYHYNQHYESFGEFTWRCEDELGPRKAGLILSQ
LGDLSNWCNGLLQEPKISLRRSSLKYLGCRYSEIKPYGLDWVELSRDLRKTCEEQTLSIP
YNDYGDSKEI
Download sequence
Identical sequences ENSNLEP00000018795 ENSNLEP00000018795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]