SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018810 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000018810
Domain Number - Region: 432-493
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000239
Family Growth factor receptor domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018810   Gene: ENSNLEG00000015495   Transcript: ENSNLET00000019755
Sequence length 783
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:27761430:27878390:1 gene:ENSNLEG00000015495 transcript:ENSNLET00000019755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWQCGTRFRGLRPAVAPWTALLALGLPGWVLAVSATAAAVVPEQHASVAGQHPLDWLLT
DRGPFHRAQEYADFMERYRQGFTTRYRIYREFARWKVNNLALERKDFFSLPLPLAPEFIR
NIRLLGRRPNLQQVTENLIKKYGTHFLLSATLGGEESLTIFVDKRKLGRKTETTGGASII
GGSGNSTAVSLETLHQLAASYFIDRESTLRRLHHIQIATGAIKVTETRTGPLGCSNYDNL
DSVSSVLVQSPENKVQLLGLQVLLPEYLRERFVAAALSYITCSSEGELVCKENDCWCKCS
PSFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQTLLKRLPDDRFLNSTAISQ
FWAMDTSLQHRYQQLGAGLKVLFKKTHRIVRRLFNLCKRCHRQPRFRLPKERSLSYWWNR
IQSLLYCGESTFPGTFLEQSHSCTCPYDQSSCQGPIPCALGEGPACAHCAPDNSTRCGSC
NPGYVLAQGLCRPEVAESLENFLGLETDLQDLELKYLLQKQDSRIEVHSIFISNDMRLGS
WFDPSWRKRMLLTLKSNKYKPGLVHVMLALSLQICLTKNSTLEPVMAIYVNPFGGSHSES
WFMPVNEGSFPEWERTNVDAAAQCQNWTITLGNRWKTFFETVHVYLRSRIKSLDDSSNET
IYYEPLEMTDPSKNLGYMKINTLQVFGYSLPFDPDAIRDLILQLDYPYTQGSQDSALLQL
IELRDRVNQLSPPGKVRLDLFSCLLRHRLKLASNEVGRIQSSLRAFNSKLPNPVEYETGK
LCS
Download sequence
Identical sequences G1RZY2
ENSNLEP00000018810 XP_003258981.1.23891 XP_012366449.1.23891 ENSNLEP00000018810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]