SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018827 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018827
Domain Number 1 Region: 589-709
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-30
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 485-593
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-30
Family Cadherin 0.00053
Further Details:      
 
Domain Number 3 Region: 268-391
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-28
Family Cadherin 0.0007
Further Details:      
 
Domain Number 4 Region: 164-272
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-22
Family Cadherin 0.0023
Further Details:      
 
Domain Number 5 Region: 697-803
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 6 Region: 379-489
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000131
Family Cadherin 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018827
Domain Number - Region: 58-128
Classification Level Classification E-value
Superfamily Cadherin-like 0.0471
Family Cadherin 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018827   Gene: ENSNLEG00000015514   Transcript: ENSNLET00000019772
Sequence length 1055
Comment pep:novel supercontig:Nleu1.0:GL397581.1:246248:294453:1 gene:ENSNLEG00000015514 transcript:ENSNLET00000019772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRVGFLIISSSSSSPLLLVSVVRVNTTNCNKCLLSGTYIFAVLLACVVFHSGAQEKNYT
IREEMPENVLIGDLLKDLNLSLIPNKSLTSAMQFKLVYKTGDVPLIRIEEDTGEIFTTGA
RIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIP
ENSAINSKYTLPAAVDPDVGINGVQNYELIKGQNIFGLDVIETPEGDKMPQLIVQKELDR
EEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVT
QLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLA
SDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKD
ADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQS
AMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDA
PPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPV
FTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNI
SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPST
NPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITVTEKCDVTDLGLHRV
LVKAHDLGQPDSLFSVVIVNLFVNESLTNATLINELVRKSTEAPVTPNTEIADVSSPTSD
YVKILVAVVAGTITVVVVIFITAVVRCRQAPHLKAAQKNKQNSEWATPNPENRQMIMMKK
KKKKKHSPKNLLLNFVTIEETKADDVDSDGNRVTLDLPIDLDEQTMGKYNWVTTPTTFKP
DSPDLARHYKSASPQPAFQIQPETPLNSKHHIIQELPLDNTFVACDSISKCSSSSSDPYS
VSECGYPMTTFEVPVSVHTRPTDSRTSTIEICSEI
Download sequence
Identical sequences ENSNLEP00000018827 ENSNLEP00000018827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]