SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018832 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018832
Domain Number 1 Region: 90-410
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.13e-65
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000277
Further Details:      
 
Domain Number 2 Region: 402-549
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.31e-27
Family Ricin B-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018832   Gene: ENSNLEG00000015496   Transcript: ENSNLET00000019777
Sequence length 552
Comment pep:known_by_projection supercontig:Nleu1.0:GL397288.1:10574222:10810611:-1 gene:ENSNLEG00000015496 transcript:ENSNLET00000019777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLTRRLVLPVFGVLWITVLLFFWVTKRKLEVPTGPEVQTPKPSDADWDDLWDQFDERR
YLNAKKWRVGDDPYKLYAFNQRESERISSNRAVPDTRHLRCTLLVYCTDLPPTSIIITFH
NEARSTLLRTIRSVLNRTPTHLIREIILVDDFSNDPDDCKQLVKLPKVKCLRNNERQGLV
RSRIRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYTRVVCPVIDIINLDTFTYIE
SASELRGGFDWSLHFQWEQLSPEQKARRLDPTEPIRTPIIAGGLFVIDKAWFDYLGKYDM
DMDIWGGENFEISFRVWMCGGSLEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAE
VWMDEYKQYYYAARPFALERPFGNVESRLDLRKNLRCQSFKWYLENVYPELSIPKESSIQ
KGNIRQRQKCLESQRQNNQETPNLKLSPCAKVKGEDAKSQVWAFTYTQQILQEELCLSVI
TLFPGAPVVLVLCKNGDDRQQWTKTGSHIEHIASHLCLDTDMFGDGTENGKEIVVNPCES
SLMSQHWDMVSS
Download sequence
Identical sequences A0A2I3G5K2
XP_003262748.1.23891 ENSNLEP00000018832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]