SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018855 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018855
Domain Number 1 Region: 164-261
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 79-171
Classification Level Classification E-value
Superfamily Immunoglobulin 6.15e-17
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000225
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018855   Gene: ENSNLEG00000015532   Transcript: ENSNLET00000019802
Sequence length 299
Comment pep:known_by_projection supercontig:Nleu1.0:GL397471.1:292794:530265:-1 gene:ENSNLEG00000015532 transcript:ENSNLET00000019802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTC
SVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVK
EGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVS
VGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYT
CVATNKLGNTNASITLYEISPSSAVAGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF
Download sequence
Identical sequences ENSNLEP00000018855 ENSNLEP00000018855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]