SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018926 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000018926
Domain Number - Region: 80-153
Classification Level Classification E-value
Superfamily Cadherin-like 0.000377
Family Dystroglycan, N-terminal domain 0.04
Further Details:      
 
Domain Number - Region: 154-186
Classification Level Classification E-value
Superfamily Photosystem I reaction center subunit X, PsaK 0.0902
Family Photosystem I reaction center subunit X, PsaK 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018926   Gene: ENSNLEG00000015565   Transcript: ENSNLET00000019878
Sequence length 437
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:25817764:25871915:-1 gene:ENSNLEG00000015565 transcript:ENSNLET00000019878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFLLSCADGINGTVNWKTRQANNFIISRKMAAGMKDVYSIFSKVHSDRNVYPSAGVLFVH
VLEREYFKGEFPPYPKPGEISNDPITFNTNLMGYPDRPGWLRYIQRTPYSDGVLYGSPTA
ENVGKPTIIEITAYNRRTFETARHNLIINIMSAEDFPLPYQAEFFIKNMNVEEMLASEVL
GDFLGAVKNVWQPERLNAINITSALDRGGRVPLPINDLKEGVYVMVGADVPFSSCLREVE
NPQNQLRCSQEMEPVITCDKKFRAQFYIDWCKISLVDKTKQVSTYQEVIRGEGILPDGGE
YKPPSDSLKSRDYYTDFLITLAVPSAVALVLFLILAYIMCCRREGVEKRNMQTPDIQLVH
HSAIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPPLHTDNYDSTNMPLMQTQQNL
PHQTQIPQQQTTGKWYP
Download sequence
Identical sequences ENSNLEP00000018926 ENSNLEP00000018926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]