SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018960 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018960
Domain Number 1 Region: 17-114
Classification Level Classification E-value
Superfamily DEATH domain 3.2e-18
Family Caspase recruitment domain, CARD 0.016
Further Details:      
 
Domain Number 2 Region: 582-663
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000016
Family PDZ domain 0.03
Further Details:      
 
Domain Number 3 Region: 856-996
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000127
Family Nucleotide and nucleoside kinases 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018960   Gene: ENSNLEG00000015606   Transcript: ENSNLET00000019915
Sequence length 1001
Comment pep:known_by_projection supercontig:Nleu1.0:GL397516.1:154065:186035:1 gene:ENSNLEG00000015606 transcript:ENSNLET00000019915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGELCRKDSALTALDEETLWEMMESHRHRIVRCVCPSRLTPYLRQAKVLCQLDEEEVLHS
PRLTNSAMRAGHLLDLLKTRGKNGAIAFLESLKFHNPDVYTLVTGLQPDVDFSNFSGLME
TSKLTECLAGAISSLQEELNQEKGQKEVLLRRCQQLQERLGLAETRAEGLHQLEADHSRM
KREVSAHFHEVLRLKDEMLSLSLHYSNALQEKELAASRCRSLQEELYLLKQELQGANMDS
SCELELQEQSLRTASDQESGDEELNRLKEENEKLRSLTFSLAEKDILDHSLRARGSRQEL
VQRIHSLRERAVAAERQREQYWEEKEQTLLQFQKSKMACQLYREKVNALQAQVCELQKER
DQAYSARDSAQREISQSLVEKDSLRRQVFELTDQVCELHTQLRQLRAEPPGVLKQEARTR
EPCPREKQRLVRMHAICPRDDSNCSLISSTESQLWSDLSATSSRELVDSFRSSSPAPPSQ
QSLYKRVAEDFGEEPWSFSSCLEIPEGDPGAPPGAKVGNPHLDYELLDTADLPQLESSLQ
PVSPGRLDVSESSVLMRRRPARRILSQVTVLAFQGHALLEQISVVGGNLTGIFIHRVTPG
SAADQMALRPGTQIVMVDYEASEPLFKAVLEDTTLEQAVGLLRRVDGFCCLSVKVNTDGY
KRLLQDLEAKVATSWDSFYIRVNLAMEGTAKGELQVHCNEVLHVTDTMFQGCGCWHAHHV
NPYTMKDTAAHGTIPNYSGAQQQLITLIQDMTQQCTRKPSSGGPQKLVRIVSMDXXXXXX
XXXXXXSPTLRILSSTGSSACFWAESCLTLVPYTLVRPHRPARPRPVLFVPRVVGKILSE
KLCLLQGFKKCLAEHLSQEEYEAWSQRGDIIQEGEVSGGHCWVTRHAVESLMEKNTHALL
DVRLDSVCAMNRMKIFPTVIHVSVNEKMAKNLKKGLQRLGTSEEQLLEAARQEEGDLDRA
PCLYSSLAPDGWSDLDGLLSCVRQAIADEQKKVVWTEQSPR
Download sequence
Identical sequences ENSNLEP00000018960 ENSNLEP00000018960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]