SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019025 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019025
Domain Number 1 Region: 489-592
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000161
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019025   Gene: ENSNLEG00000015660   Transcript: ENSNLET00000019981
Sequence length 617
Comment pep:known_by_projection supercontig:Nleu1.0:GL397516.1:199655:231084:1 gene:ENSNLEG00000015660 transcript:ENSNLET00000019981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPPSPTIEMPSSVTALGRARSSGPRMAPSACCCSPAAVQRRLPILAWLPSYSLQWLK
MDFVAGLSVGLTAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMS
LLVSFYTFHEPAYAVLLAFLSGCIQLAMGVLRLGFLLDFISCPVIKGFTSAAAVTIGFGQ
TKNLLGLQNIPRQFFLQVYHTFLRIAETRVGDAILGLVCMLLLLVLKLMRDHMPPIHPEM
PPGVRLSHGLVWAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFS
VTTANGTISFTEMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTN
MLGSLVSSYPVTGSFGRTAVNAQSGVCTPAGGLVTGTLVLLSLDYLTSLFYYIPKSALAA
VIIMAVAPLFDTKIFRTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGTLVSLLMILHAAA
RPETKVSEGPVLVMQPASGLSFPAVEALREEILSRALAVSPPRCLVLECTHVCSIDYTVV
LGLGELLQDFQKEGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPY
NIREDSVPDHKVALLKA
Download sequence
Identical sequences ENSNLEP00000019025 XP_012367980.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]