SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019052 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019052
Domain Number 1 Region: 199-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 2 Region: 78-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 157-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000141
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 121-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000293
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019052
Domain Number - Region: 55-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0127
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019052   Gene: ENSNLEG00000015684   Transcript: ENSNLET00000020009
Sequence length 373
Comment pep:known_by_projection supercontig:Nleu1.0:GL397390.1:210917:218871:1 gene:ENSNLEG00000015684 transcript:ENSNLET00000020009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XMLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCEE
PGQCICTDGWDGELCDTDVRACSSTPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGP
CVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGG
DFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRAL
SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKNTPLLTEGQAICFTIL
GVLTSLVVLGTVGIIFLNKCEAWVSSLRHNHMLRKKKNLLLQYNSGEDLAVNIIFPEKID
MTTFSKEAGDEEI
Download sequence
Identical sequences ENSNLEP00000019052 ENSNLEP00000019052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]